"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J9WIH3"	"{'domain_architectures': 17395, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 17395}"	"['Bifunctional enzyme that catalyzes both the deamination of dCTP to dUTP and the hydrolysis of dUTP to dUMP without releasing the toxic dUTP intermediate']"	"dcd"	"[{'identifier': 'GO:0008829', 'name': 'dCTP deaminase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006229', 'name': 'dUTP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"J9WIH3_MYCIP"	"f774514846d93fa2755fff8e65204fb50c24e420"	True	False	False	190	"dCTP deaminase, dUMP-forming"	3	""	"MLLSDRDLRAEISASRLGIDPFDDALVQPSSIDVRLDCMFRVFNNTRYTHIDPAKQQDELTTLVEPVEGEPFVLHPGEFVLGSTLELITLPEDLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCILRLTSPAEHPYGSSRVGSKYQGQRGPTPSRSYQNFISST"	"unreviewed"	"{'taxId': '1232724', 'scientificName': 'Mycobacterium indicus pranii (strain DSM 45239 / MTCC 9506)', 'fullName': 'Mycobacterium indicus pranii (strain DSM 45239 / MTCC 9506)'}"