"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J8IGD1"	"{'domain_architectures': 4998, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 3, 'pfam': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4998}"	"['Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein']"	"IIG_01026"	""	"J8IGD1_BACCE"	"359fb5b06e8ba1341092b7594cbdf649b4ed6456"	True	False	False	110	"UPF0122 protein IIG_01026"	3	""	"MLEKTTRMNYLFDFYQSLLTQKQRSYMSLYYLDDLSLGEIAEEFDVSRQAVYDNIKRTEAMLEEYEDKLVLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD"	"unreviewed"	"{'taxId': '1053226', 'scientificName': 'Bacillus cereus VD048', 'fullName': 'Bacillus cereus VD048'}"