"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J8FJJ0"	"{'domain_architectures': 45561, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 45561}"	"['Binds as a heterodimer with protein bS6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit']"	"rpsR"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"J8FJJ0_BACCE"	"401c805a0828824c1f9608ac9edb919a1c016653"	True	False	False	77	"Small ribosomal subunit protein bS18"	3	""	"MAGRKGGRAKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPYVGE"	"unreviewed"	"{'taxId': '1053219', 'scientificName': 'Bacillus cereus MC67', 'fullName': 'Bacillus cereus MC67'}"
