"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J7S7F0"	"{'domain_architectures': 35144, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 35144}"	"['Required for retention of late Golgi membrane proteins. Component of the retrieval machinery that functions by direct interaction with the cytosolic tails of certain TGN membrane proteins during the sorting/budding process at the prevacuolar compartment. Binds phosphatidylinositol 3-phosphate (PtdIns(P3))']"	"KNAG0E00280"	"[{'identifier': 'GO:0035091', 'name': 'phosphatidylinositol binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"J7S7F0_HUIN7"	"ad261f154f38ce159e1eb6f55507e37aff327fbd"	True	False	False	158	"Sorting nexin-3"	3	"UP000006310"	"MRPFQSFSTTEHSTFSSPSPTGPDTPAQYGEPESLMEVEVGAPQTHKIGGETFTDYEVTARTNLPGYARGTTVVRRRYSDFEHLRQCLKNEMVVTNRTRVKIPHLPGKIFLSNRFDERVIEERQRGLDKWLKSVAGHPLLQVGSAVLVRFLQSRVFSG"	"unreviewed"	"{'taxId': '1071383', 'scientificName': 'Huiozyma naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / KCTC 17520 / NBRC 10181 / NCYC 3082 / Yp74L-3)', 'fullName': 'Huiozyma naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / KCTC 17520 / NBRC 10181 / NCYC 3082 / Yp74L-3) (Yeast)'}"
