"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J7R389"	"{'domain_architectures': 250306, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 250306}"	"['Catalyzes the hydrolysis of nucleoside triphosphates, with a preference for pyrimidine deoxynucleoside triphosphates (dUTP, dTTP and dCTP)']"	"nudI"	"[{'identifier': 'GO:0016818', 'name': 'hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"J7R389_ECOLX"	"752b3b6d9807717ea1f029db1420a2538cb188ca"	True	False	False	141	"Nucleoside triphosphatase NudI"	3	""	"MRQRTIVCPLIQNDGAYLLCKMADDRGVFPGQWALSGGGVESGERIEEALRREIREELGEQLLLTEITPWTFSDDIRTKTYADGRKEEIYMIYLIFDCVSANREVKINEEFQDYAWVKPEDLVHYDLNVATRKTLRLKGLL"	"unreviewed"	"{'taxId': '562', 'scientificName': 'Escherichia coli', 'fullName': 'Escherichia coli'}"