"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J7K7M7"	"{'domain_architectures': 3182, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3182}"	"['Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, L2 escorts the genomic DNA into the nucleus by promoting escape from the endosomal compartments and traffic through the host Golgi network. Mechanistically, the C-terminus of L2 possesses a cell-penetrating peptide that protudes from the host endosome, interacts with host cytoplasmic retromer cargo and thereby mediates the capsid delivery to the host trans-Golgi network. Plays a role through its interaction with host dynein in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to host PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA']"	"L2"	"[{'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019028', 'name': 'viral capsid', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"J7K7M7_BPV1"	"111c6476719869e9b14cd4870c1778364df3cd7b"	False	False	False	467	"Minor capsid protein L2"	3	""	"MSARKRVKRASAYDLYRTCKQAGTCPPDVIPKIEGETIADKILKFGALAVYFGGLGIGTWSSGRVAAGGSPRYTPLRTSGSISSLASAGSRAGTTTRSSINTGIALDTLESLGAFRPAAYDDSILPDAPAIVTPDAIPADTGIDGLSIGTDSSSETLITFLDPEGSEDIAVLELQPLDHPNWQVSNPFHHSAAYHAPLQLQSSIAETSGLENIFVGGSGLGDTGGENIELTYFGSPRTSTPQTQSQPFKGILNWFSKRYYTQVPVEDPEILTAETFENPVYDPEPTALKGPSGRVGLSQVYRPDFIETRGGGQVGPQLHVRYSFSTIAEDLEPVSYAVDEDTQGLSFLPLHEEQGEFEDIELDEFSDTQRLLSESKYTAPIGSGVRRALVTGQEVTAARPTGVVTYGSPDIYHTSSVDLDSISPIIVIDDITNTPVIIIDGHIVDLYSRNYSLHPSLYRKRKKRKHA"	"unreviewed"	"{'taxId': '2758380', 'scientificName': 'Bos grunniens papillomavirus 1', 'fullName': 'Bos grunniens papillomavirus 1'}"
