"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J4UQP6"	"{'domain_architectures': 7424, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7424}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"BBA_03497"	"[{'identifier': 'GO:0022900', 'name': 'electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"J4UQP6_BEAB2"	"7d08acc96e67df28954006f7df1944355b000148"	True	False	False	200	"NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial"	3	"UP000002762"	"MATLRSQGVARILRTAAAPRVAVPMTAQRFQSSIAKHSEKEVTGTPSDANQPDFDTPHDKATSTFTPVPRHAQDGTDDVRSAAVTSGAPIELQARTVRIYKESKAATQSGTWRGHDWRMDWDILPKGHRWENPLMGWQSSGDFMQGTNLNFETKEDAIHFAEKQGYEYFVQEPNARKFTPKAYANNFLYSARKLKHIRTK"	"unreviewed"	"{'taxId': '655819', 'scientificName': 'Beauveria bassiana (strain ARSEF 2860)', 'fullName': 'Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus)'}"
