"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J3TEU0"	"{'domain_architectures': 18609, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 1, 'pfam': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 18609}"	"['Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation']"	"rpsC"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"J3TEU0_CARRU"	"7cf99984b5ae2ca0b627895b62fb9dcc7598873c"	True	False	False	203	"Small ribosomal subunit protein uS3"	3	""	"MGKKINPVLFRLKKNSVYHSLWYNIKKKYFYYLKCDILIREIIRKNFLFINLSYIDIIISNKLIINLYINNIDLLNDIENYLDIFIFQISKILKKNIILNFVFNYVLNAKNIAINVVNQILNKNSIKKIIKKEIFNNRKNLGCKIQISGRLDGVDIARKEWSLLGRIPLHTIKYNLEYYCCETLIQYGILGIKVWLFKKKNEK"	"unreviewed"	"{'taxId': '1202540', 'scientificName': 'Candidatus Carsonella ruddii PC isolate NHV', 'fullName': 'Candidatus Carsonella ruddii PC isolate NHV'}"