"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J3KP27"	"{'domain_architectures': 7999, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'smart': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7999}"	"['Core component of the TRAPP complexes which has a function of guanine nucleotide exchange factor activity for Rab1 GTPase. Plays a role in vesicular transport from endoplasmic reticulum to Golgi and autophagy. May play a role in dendrite postsynaptic membrane trafficking']"	"TRAPPC4"	"[{'identifier': 'GO:0016192', 'name': 'vesicle-mediated transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030008', 'name': 'TRAPP complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"J3KP27_HUMAN"	"01c70fce1f059b606197d5d1a38b4caee0ef25e0"	True	False	False	181	"Trafficking protein particle complex subunit"	1	"UP000005640"	"MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTEMPIRCELFDQNLKLALEVAEKAGTFGPGS"	"unreviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"