"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J2ZR68"	"{'domain_architectures': 34638, 'entries': 18, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'profile': 1, 'pfam': 2, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 34638}"	"['Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body', 'With S4 and S12 plays an important role in translational accuracy']"	"rpsE"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"J2ZR68_9LACO"	"ddb47877d1b64f864fa25e376c154e201459d42b"	True	False	False	168	"Small ribosomal subunit protein uS5"	3	""	"MAKAFIDPNKLDLEDNVVSINRVTKVVKGGRRLRFAAIVIVGDHNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPIVGTTVPHEIIGRFGGARILIKPAIAGSGVAAGGAVRSIMELAGVQDVTSQFLGSHTPINVVRATMEGLKGLRRAEKVAELRGIPVDQLEN"	"unreviewed"	"{'taxId': '1185325', 'scientificName': 'Loigolactobacillus coryniformis subsp. coryniformis CECT 5711', 'fullName': 'Loigolactobacillus coryniformis subsp. coryniformis CECT 5711'}"