GET /api/protein/UniProt/I7JHT1/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I7JHT1",
"id": "I7JHT1_HBV",
"source_organism": {
"taxId": "489450",
"scientificName": "HBV genotype A1",
"fullName": "HBV genotype A1"
},
"name": "Protein X",
"description": [
"Multifunctional protein that plays a role in silencing host antiviral defenses and promoting viral transcription. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding host CFLAR, a key regulator of the death-inducing signaling complex (DISC). Promotes viral transcription by using the host E3 ubiquitin ligase DDB1 to target the SMC5-SMC6 complex to proteasomal degradation. This host complex would otherwise bind to viral episomal DNA, and prevents its transcription. Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT",
"Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with host factors"
],
"length": 154,
"sequence": "MAARMYCQLDSSRDVLCLRPVSAESRGRPLPGPLGDLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA",
"proteome": null,
"gene": "X",
"go_terms": [
{
"identifier": "GO:0019079",
"name": "viral genome replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "081766d53e85ec9d070716190b21b776cf49b734",
"counters": {
"domain_architectures": 14317,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 14317
}
}
}