"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I6T4G1"	"{'domain_architectures': 0, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1}"	"['Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II']"	""	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"I6T4G1_9TELE"	""	True	False	True	67	"FACT complex subunit SSRP1"	3	""	"EDVERRFEGKLSKNMSGSLYEMVSRVMKSLVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERG"	"unreviewed"	"{'taxId': '202064', 'scientificName': 'Parachaenichthys georgianus', 'fullName': 'Parachaenichthys georgianus'}"