"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I6NE82"	"{'domain_architectures': 85, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 2, 'panther': 1, 'hamap': 2, 'ncbifam': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 85}"	"['Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and dUMP as phosphate acceptors, but can also use CMP, dCMP and AMP']"	"URA6"	"[{'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019205', 'name': 'nucleobase-containing compound kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006139', 'name': 'nucleobase-containing compound metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016776', 'name': 'phosphotransferase activity, phosphate group as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006207', 'name': ""'de novo' pyrimidine nucleobase biosynthetic process"", 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006221', 'name': 'pyrimidine nucleotide biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"I6NE82_ERECY"	"d75e243d86ccdd63a871f49ae0b607155434bdb8"	True	False	False	301	"Uridylate kinase"	3	"UP000006790"	"MFRTSRSRIIAQNKVVSCKLSSMCVPLRASFLIHRRKMKIPTGRFFSSTPNSEKSDPSKGKYRGTILTLLGALAIGSTLFSIGYQRSSPKELLEDNEHTGDSPGNLAQDVSVIFVLGGPGAGKGTQCARLVEKLGFVHVGAGDLLRDEQNRPGSQYGDLIKDYIKEGLIVPQEITVALLKRAIEESYKKGKKNFLVDGFPRKMDQAITFEKEVTPSKFVLFFDCPEKVMLERLLVRSQTSGRTDDNIESIKKRFKTFIDTSLPVVEYFEAQDRVVKIRCDQPVDQVYNHVENEVSRRLGVK"	"unreviewed"	"{'taxId': '931890', 'scientificName': 'Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582)', 'fullName': 'Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast)'}"