"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I6EAC3"	"{'domain_architectures': 85258, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 85258}"	"[""Trims short 3' overhangs of a variety of RNA species, leaving a one or two nucleotide 3' overhang. Responsible for the end-turnover of tRNA: specifically removes the terminal AMP residue from uncharged tRNA (tRNA-C-C-A). Also appears to be involved in tRNA biosynthesis""]"	"rnt"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004540', 'name': 'RNA nuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"I6EAC3_SHIBO"	"5aad122e81bfc5b649ae462596f1030cc5a1692e"	True	False	False	215	"Ribonuclease T"	3	""	"MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMIAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLPAAEEV"	"unreviewed"	"{'taxId': '766140', 'scientificName': 'Shigella boydii 4444-74', 'fullName': 'Shigella boydii 4444-74'}"