"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I5AQE2"	"{'domain_architectures': 27006, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'smart': 3, 'pfam': 2, 'cdd': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 27006}"	"['Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal recognition particle (SRP) and the ribosome-nascent chain (RNC)']"	"ftsY"	"[{'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006614', 'name': 'SRP-dependent cotranslational protein targeting to membrane', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"I5AQE2_EUBC6"	"f314f88e96f5face42ce1f6d3cd28912b5731c32"	True	False	False	307	"Signal recognition particle receptor FtsY"	3	"UP000005753"	"MGFFKRLFSGLTKSRDSIQENLDEAFGCSEIDDEFYENLEEALVASDMGIETTQTVIENLQDIVADLDIKKPADCKKYMVDCFRQQMNVGQTDYSFEDRKSVVLIIGVNGVGKTTTVGKLAAKYKATGKKVMIAAADTFRAAAIPQLETWANRAGVEIIEGQEGADPASVVYDAISAAKARDTDMLLIDTAGRLHNKKNLMEELRKIYRILAKSYPEASLETLLVLDGTTGQNAILQARSFAEVADITGLVITKLDGTAKGGIAVAVQSELDIPVKYIGVGEQLDDLQKFDPSAYVDALFDTGRRDD"	"unreviewed"	"{'taxId': '633697', 'scientificName': 'Eubacterium cellulosolvens (strain ATCC 43171 / JCM 9499 / 6)', 'fullName': 'Eubacterium cellulosolvens (strain ATCC 43171 / JCM 9499 / 6)'}"
