HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3VRB9",
"id": "I3VRB9_THESW",
"source_organism": {
"taxId": "1094508",
"scientificName": "Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485)",
"fullName": "Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485)"
},
"name": "Tyrosine--tRNA ligase",
"description": [
"Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr)"
],
"length": 405,
"sequence": "MSVFDVLKERNFIQQMTHEDEIKELLEKEKVTFYIGFDPTADSLHVGHFLQLMVMAHMQRAGHRPIALIGGGTAMIGDPTGKTDMRKMLTKDEIDHNAEAFKRQMSRFIDFSDGKAILANNADWLLNLNYVEFLRDIGVHFSVNKMLTAECFKTRLERGLSFLEFNYMLMQAYDFLMLNKEYGCVLQMGGDDQWSNILAGVDLIRRKEGKQAYGMTFTLLTTSEGKKMGKTEKGAIWLDADKTPPYDFYQYWRNIDDSDVEKCLSLLTFLPMDEVRRLGSLKDKEINEAKKVLAYEVTKLVHGVDEAEKAKKAAEALFEGRGDLSNVPTSTITSDMLGSNLLDVLVKTGIIPSKSEGRRLITQGGLYVNDENVKDVNAVVTEDMFKEGYMILRRGKKSYNKIILT",
"proteome": "UP000006178",
"gene": "tyrS",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004831",
"name": "tyrosine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006437",
"name": "tyrosyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "358aa92589ac960f552ae318a22a0379863459e9",
"counters": {
"domain_architectures": 14047,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 2,
"cdd": 2,
"pfam": 2,
"profile": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14047
}
}
}