"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I2GZ20"	"{'domain_architectures': 14683, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14683}"	"['Catalyzes the synthesis of activated sulfate']"	"TBLA0B05430"	"[{'identifier': 'GO:0004020', 'name': 'adenylylsulfate kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000103', 'name': 'sulfate assimilation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"I2GZ20_HENB6"	"1c59cf68b0cca9e4b38bd0f18061a8656471c2b7"	True	False	False	199	"Adenylyl-sulfate kinase"	3	"UP000002866"	"MTAKNITWHQGISYEERISLRGQKGYTLWFTGLSGSGKSTIACALEELLLKKKYSVYRLDGDNIRFGLNKDLGFSEDDRNENIRRISEVSKLFADSCAISITSFISPYLKERNNARLLHEEVGLPFIEIFVDAPLHIVEERDPKGLYKKARAGEIKEFTGISAPYEKPVNPEIHIKSDENTIEESVDIIYKYLLDKKLL"	"unreviewed"	"{'taxId': '1071380', 'scientificName': 'Henningerozyma blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7)', 'fullName': 'Henningerozyma blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast)'}"