"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H9LG55"	"{'domain_architectures': 44419, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 44419}"	"['Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0)', 'F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation']"	"atpF"	"[{'identifier': 'GO:0015078', 'name': 'proton transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015986', 'name': 'proton motive force-driven ATP synthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045259', 'name': 'proton-transporting ATP synthase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"H9LG55_GOSHI"	"fa1ba68571565fd588f67ea2f853ca4d56800daf"	True	False	False	184	"ATP synthase subunit b, chloroplastic"	3	"UP000818029"	"MKNVTDSFVSLGHWPSAGSFGVNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKERILNTIRNSEELRGGAIERLEKARARLRKVEMEADQFRVNGYSEIEREKLNLINSTYKILEQLENYKNETIYFEQQRAINQVRQRVFQQALQGALGTLNSSLNNELHLRTISANIGLFGVMKEITD"	"unreviewed"	"{'taxId': '3635', 'scientificName': 'Gossypium hirsutum', 'fullName': 'Gossypium hirsutum (Upland cotton)'}"
