"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H8WXV9"	"{'domain_architectures': 4019, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4019}"	"['Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors']"	"MED10"	"[{'identifier': 'GO:0003712', 'name': 'transcription coregulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006357', 'name': 'regulation of transcription by RNA polymerase II', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016592', 'name': 'mediator complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"H8WXV9_CANO9"	"73eaa37955c08ba972ca6d35efef10f8a672c539"	True	False	False	151	"Mediator of RNA polymerase II transcription subunit 10"	3	"UP000005018"	"MTTTSIAPTEDNASLVQAAEKVANLIESFIELGILVHDNQGTPQSNLALSNKIQTLASQLKAVSHSDGLKDKLVPIDVVSYIEDGRNPDIYTREFIEVTAKSNAKLKGKMQGFNKLGNILSEKLVQEYPRLEAGLKDIKSRTTFDSLSTYD"	"unreviewed"	"{'taxId': '1136231', 'scientificName': 'Candida orthopsilosis (strain 90-125)', 'fullName': 'Candida orthopsilosis (strain 90-125) (Yeast)'}"
