"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H3GD79"	"{'domain_architectures': 17178, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17178}"	"['Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space']"	""	""	"H3GD79_PHYRM"	"f9178374a5901be0d54a7f9dfe55ffbddb0efa3a"	True	False	False	104	"Mitochondrial import inner membrane translocase subunit"	3	"UP000005238"	"MNFGGMMGGGATPGAPQQPSQQSQLMMAKVEMASYADLFERLSRVCFQKCKFKYNDGQLNVGEMSCIDRCAGKYMQAYSSLGVKMAQVEKEIMDQAGASAGVQQ"	"unreviewed"	"{'taxId': '164328', 'scientificName': 'Phytophthora ramorum', 'fullName': 'Phytophthora ramorum (Sudden oak death agent)'}"