"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H3ATC2"	"{'domain_architectures': 56741, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'prints': 2, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 56741}"	"['Histone deacetylase that catalyzes the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Also involved in the deacetylation of cohesin complex protein SMC3 regulating release of cohesin complexes from chromatin. May play a role in smooth muscle cell contractility. In addition to protein deacetylase activity, also has protein-lysine deacylase activity: acts as a protein decrotonylase by mediating decrotonylation ((2E)-butenoyl) of histones']"	"HDAC8"	"[{'identifier': 'GO:0004407', 'name': 'histone deacetylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"H3ATC2_LATCH"	"c77293cf1dae780d80071e39464acf28cc65f89f"	True	False	False	379	"Histone deacetylase 8"	3	"UP000008672"	"MEEYPGSQPSSLVRQPAVVYIYSPEYISICDSLSKVPNRASMVHSLIEAYGLLKYMRVVKPKVATMEEMATFHTDAYLQHLQKVSEEGDEDHPESGEYGLGYDCPTTEGIFDYAAAVGGASLTAAQCLIDRSCKIAINWPGGWHHAKKDEASGFCYINDAVLGILKLRQKYERVLYVDLDLHHGDGVEDAFSFTSKVMTVSFHKYSFGFFPGTGDVTDIGLGKGRCYAVNVPLQDGIQDDKYFQICESILKEVYTAFSPQAVVLQLGADTLAGDPMCSFNMTPLGVEKCLKYVLQWELPTLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHKYFTEYGPDYVLEITPSCRPDRNDPQQIQNILSSVKGNLKNVV"	"unreviewed"	"{'taxId': '7897', 'scientificName': 'Latimeria chalumnae', 'fullName': 'Latimeria chalumnae (Coelacanth)'}"
