"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H2N0A7"	"{'domain_architectures': 65153, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 65153}"	"['Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. FOS has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation']"	"ATF3"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006357', 'name': 'regulation of transcription by RNA polymerase II', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"H2N0A7_ORYLA"	"890c9e17a3b426c841f953529dd29b6d471f4ea1"	True	False	False	212	"BZIP domain-containing protein"	4	"UP000001038"	"MMLQHLGPSLADISCSALVPCLSPPGELTLEDFTNFTPIVKEELRQVIQNKRLSCGLSADASSDSASSASDQAPPTHESGVKRELTLEEHDRKKRRRERNKIAAAKCRSKKKEKTEGLQKESEKLESINADLKAQIEELKQQKQQLVYMLNLHRPTCIVRAQDGQTPEDERNLFLQHIKESNFQLHSLTSTTEGLLGGGPLSLDHICCPADL"	"unreviewed"	"{'taxId': '8090', 'scientificName': 'Oryzias latipes', 'fullName': 'Oryzias latipes (Japanese rice fish)'}"