General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2D447",
        "id": "H2D447_BORBN",
        "source_organism": {
            "taxId": "521007",
            "scientificName": "Borreliella burgdorferi (strain N40)",
            "fullName": "Borreliella burgdorferi (strain N40)"
        },
        "name": "Variable large protein",
        "description": [
            "The Vlp and Vsp proteins are antigenically distinct proteins, only one vlp or vsp gene is transcriptionally active at any one time. Switching between these genes is a mechanism of host immune response evasion"
        ],
        "length": 87,
        "sequence": "GMIKAAEEAIVGATGDGTKIGESAANGAAADANSVKNIAKGMKGIVDAAGTAAGKKDGALKDVQDAGAADQETGKLFGTARGGDAKL",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "ida_accession": "20d9771c48dcd674b13635feb829a151d48a5f52",
        "counters": {
            "domain_architectures": 549,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 549
        }
    }
}