"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H0W8B2"	"{'domain_architectures': 22787, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'profile': 2, 'smart': 2, 'ssf': 2, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22787}"	"['Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins']"	"SLA"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"H0W8B2_CAVPO"	"8797a2809872b61a223c5f69e3b5d4c1858c033a"	True	False	False	292	"Src-like-adapter"	4	"UP000005447"	"MHSELVSPAAPGERDMGNSIKSTPAPPERPLPSTDGLESDFLAVLSDYPSPDISPPIFRQGEKLRVISDEGDWWKAISLSSGRESYIPGIYVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLAQSLPSPAARAPSSPVVTLRQKTFDWKRASRLQDNPQGAGNPLGVDESLFSYGLRESIASYLSLTGDDASPFDRKKKSVSLIYSGSRRKSSLFSASQYFED"	"unreviewed"	"{'taxId': '10141', 'scientificName': 'Cavia porcellus', 'fullName': 'Cavia porcellus (Guinea pig)'}"