"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G9K2P6"	"{'domain_architectures': 4804, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'smart': 1, 'pfam': 2, 'cathgene3d': 2, 'profile': 1, 'panther': 1, 'prints': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4804}"	"[""Acts as component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity""]"	"MCM7"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003678', 'name': 'DNA helicase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006270', 'name': 'DNA replication initiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042555', 'name': 'MCM complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G9K2P6_9EURO"	"c4da101550b82c589ed0a28ad40713455d60288f"	True	False	True	209	"DNA replication licensing factor MCM7"	3	""	"KPAVQINAYTCDRCGCEVFQPITTKQFLPLTECLSEECKKNNSKGQLFLSTRASKFVPFQEVKIQEMADQVPVGHIPRTLTVHCHGALTRQLNPGDVIDVAGIFLPTPYTGFRAIRAGLLTDTYLEAQHITQHKKSYNEMGMDSRTLRKIEQHMRSGNMYEYLSRSIAPEIYGHLDVKKALLLLLIGGVTKEMGDGMHIRGDINICLMG"	"unreviewed"	"{'taxId': '36655', 'scientificName': 'Penicillium aurantiogriseum', 'fullName': 'Penicillium aurantiogriseum'}"
