"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G8ZM48"	"{'domain_architectures': 36205, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'hamap': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 36205}"	"['Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane']"	"TDEL0A03600"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G8ZM48_TORDE"	"cdd933c6972e36df20e8c3059e624fe397bc606f"	True	False	False	164	"Large ribosomal subunit protein uL13m"	3	"UP000005627"	"MSQKVGHSSLAFARLWHHVDLARDKRTLGRLASAIAITLIGKHKPVYHQSQDCGDYVVVSNCQRLRVTGKKLEQKTYWSHSSKPGHLKLRTMEKVVADKGFGEILKKAVSGMLPKNKLRKPRLERLKVFDGADHPYKQNITAFVYDQPYVQSKLKQLKASEEVK"	"unreviewed"	"{'taxId': '4950', 'scientificName': 'Torulaspora delbrueckii', 'fullName': 'Torulaspora delbrueckii (Yeast)'}"