"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G8DZM3"	"{'domain_architectures': 627, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'hamap': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 627}"	"['Plays a crucial role in virion assembly and budding. Expressed late in the virus life cycle, it acts as an inhibitor of viral transcription and RNA synthesis by interacting with the viral polymerase L. Presumably recruits the NP encapsidated genome to cellular membranes at budding sites via direct interaction with NP. Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. The budding of the virus progeny occurs after association of protein Z with the viral glycoprotein complex SSP-GP1-GP2 at the cell periphery, step that requires myristoylation of protein Z. Also selectively represses protein production by associating with host eIF4E. In cell-based minigenome assay, has an inhibitory effect on the ribonucleoprotein machinery (vRNP), which is responsible for the replication and transcription of the viral genome']"	"Z"	"[{'identifier': 'GO:0046761', 'name': 'viral budding from plasma membrane', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G8DZM3_TAMVU"	"02f5658b1c1e9cf0685e54bef94397c307c50a4f"	False	False	False	95	"RING finger protein Z"	3	""	"MGLRYSKEVRDRYGDKDPEGRIPITQTMPQTLYGRYNCKSCWFANKGLIKCSNHYICLRCLTSMLNRTDYCEICGEVLPKKLTFETTPTAPPYTP"	"unreviewed"	"{'taxId': '3052329', 'scientificName': 'Tamiami mammarenavirus (isolate Rat/United States/W 10777/1964)', 'fullName': 'Tamiami mammarenavirus (isolate Rat/United States/W 10777/1964) (TAMV)'}"
