GET /api/protein/UniProt/G7WMS7/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G7WMS7",
        "id": "RL3_METH6",
        "source_organism": {
            "taxId": "1110509",
            "scientificName": "Methanothrix harundinacea (strain 6Ac)",
            "fullName": "Methanothrix harundinacea (strain 6Ac)"
        },
        "name": "Large ribosomal subunit protein uL3",
        "description": [
            "One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit"
        ],
        "length": 335,
        "sequence": "MATIHRPRRGSLAFSPRKRAKSQVPRTRYWAAGEEKARMDGFAGYKAGMTHIIMIDDKPNSLTEGMEISVPVTILETPPLSIAALRVYEKYNGGVRAAGEAWSDKLDPSLARSITVPKNKRGAAIDEIGAIIEDMEELRLIAHTNPKLLTGVPKKNPDLMEIQVNGGNIANQFELAKSLLGSSVPISSIFSPGSIIDVSAITKGKGVQGPVKRWGINLQKRKHSRGGKRRHIGNLGPWNPHHVRWTVPLLGQMGYHQRTEFNKRVLAIGSDGGAITPDGGFPGYGIIRGEYAILSGSVPGPSKRLVRMRSAVRAKDADLKTPQVLYVSRDSKQGL",
        "proteome": "UP000005877",
        "gene": "rpl3",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "a08494054ebbd1211fe1504167e3ff441c57a831",
        "counters": {
            "domain_architectures": 29508,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 3,
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29508
        }
    }
}