"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G7V5X3"	"{'domain_architectures': 4301, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4301}"	"['Acts as an anti-CsrA protein, binds CsrA and prevents it from repressing translation of its target genes, one of which is flagellin. Binds to flagellin and participates in the assembly of the flagellum']"	"fliW"	"[{'identifier': 'GO:0044780', 'name': 'bacterial-type flagellum assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G7V5X3_THELD"	"6483b8055959ceab2543805fb1db9a6f4552cc1e"	True	False	False	163	"Flagellar assembly factor FliW"	3	"UP000005868"	"MGIKVQTIIMGEVEVDEKAIITFPNGLPGFGGAKRWFFAGEDEDVIKWMICLDCGHICLPVTSPEVVDPAYSPHIPEENLKRLRLSSLDEGVLMVVLNLPRDKPWMGTANLLAPIIINPSLRLGEQVVLMDERYSVRTPLVSEEERAKIEQSIEAPKRQGGEE"	"unreviewed"	"{'taxId': '580340', 'scientificName': 'Thermovirga lienii (strain ATCC BAA-1197 / DSM 17291 / Cas60314)', 'fullName': 'Thermovirga lienii (strain ATCC BAA-1197 / DSM 17291 / Cas60314)'}"
