"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G7MJ50"	"{'domain_architectures': 4640, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4640}"	"['DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively']"	"POLR2H"	"[{'identifier': 'GO:0003899', 'name': 'DNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G7MJ50_MACMU"	"370c379e323b06b4097a2b7b6aa86a00b38755e7"	True	False	False	150	"DNA-directed RNA polymerases I, II, and III subunit RPABC3"	2	"UP000006718"	"MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF"	"unreviewed"	"{'taxId': '9544', 'scientificName': 'Macaca mulatta', 'fullName': 'Macaca mulatta (Rhesus macaque)'}"
