"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G7DV28"	"{'domain_architectures': 30896, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30896}"	""	"Mo01090"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0000463', 'name': 'maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0022625', 'name': 'cytosolic large ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G7DV28_MIXOS"	"711924de1a0dd8285cf1d4531ce96a2804131cc6"	True	False	False	125	"60S ribosomal protein L35"	3	"UP000009131"	"MSSSSKVKAHELVSKSKADLMKQLEELKQEATALRVQKVTGGNQSKLQKIKTVRKSIARVLTVVNAKQRQAVREHSKNKRLPLDLRPKKTRAIRRRLSKSERTAKTERTKKRLAAFPQRKYAVKA"	"unreviewed"	"{'taxId': '764103', 'scientificName': 'Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970)', 'fullName': 'Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970)'}"
