"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5S892"	"{'domain_architectures': 4096, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'ssf': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4096}"	"['May act as an anti-Gre factor']"	"rnk"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0032784', 'name': 'regulation of DNA-templated transcription elongation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0070063', 'name': 'RNA polymerase binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G5S892_SALET"	"0365cbd7efdfc865b54f46b2047eac56b8cf0ea8"	True	False	False	136	"Regulator of nucleoside diphosphate kinase"	3	""	"MSRPTIIINDLDAERIDRLLEQPAYADLPIADALNAELDRAQMCSPQEMPNDVVTMNSRVKFRNLSDGETRVRTLVYPANMTDSSTQLSVMAPVGAALLGLRVGDTIHWELPGGASTHLEVLELEYQPEAAGDFLR"	"unreviewed"	"{'taxId': '913086', 'scientificName': 'Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580', 'fullName': 'Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580'}"