"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5QJ54"	"{'domain_architectures': 111255, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 111255}"	"['Repressor of the marRAB operon which is involved in the activation of both antibiotic resistance and oxidative stress genes. Binds to the marO operator/promoter site']"	"LTSERUB_2635"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G5QJ54_SALRU"	"c05eb032d332a0d94b62632186a9c95f4128f5eb"	True	False	False	144	"Multiple antibiotic resistance protein MarR"	4	""	"MKSTSDLFNEIIPLGRLIYMVNQKKDRLLNNYLSPLDITATQFKVLCSIRCAGCITPVELKKVLSVDLGALTRMLDRLLCKGWIERLPNPNDKRGVLVKLTPDGAAICEQCHQRPGQDLHQELTKNLTADEVATLEYLLKKILP"	"unreviewed"	"{'taxId': '913081', 'scientificName': 'Salmonella enterica subsp. enterica serovar Rubislaw str. A4-653', 'fullName': 'Salmonella enterica subsp. enterica serovar Rubislaw str. A4-653'}"