"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5Q665"	"{'domain_architectures': 26938, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26938}"	"['A scaffold on which IscS assembles Fe-S clusters. It is likely that Fe-S cluster coordination is flexible as the role of this complex is to build and then hand off Fe-S clusters']"	"LTSEMON_3719"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G5Q665_SALMO"	"1a14465eba7d2532ef70113b6acb6327d7aa9427"	True	False	False	128	"Iron-sulfur cluster assembly scaffold protein IscU"	3	""	"MAYSEKVIDHYENPRNVGSFDNNDDNVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKIHCSILAEDAIKAAIADYKSKREAK"	"unreviewed"	"{'taxId': '913242', 'scientificName': 'Salmonella enterica subsp. enterica serovar Montevideo str. S5-403', 'fullName': 'Salmonella enterica subsp. enterica serovar Montevideo str. S5-403'}"