"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5CYK3"	"{'domain_architectures': 2017, 'entries': 26, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 3, 'cdd': 1, 'pfam': 4, 'smart': 1, 'profile': 3, 'panther': 1, 'prosite': 1, 'interpro': 10}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2017}"	"[""Catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T-lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities. DNA cleavage occurs in 2 steps: a first nick is introduced in the top strand immediately upstream of the heptamer, generating a 3'-hydroxyl group that can attack the phosphodiester bond on the opposite strand in a direct transesterification reaction, thereby creating 4 DNA ends: 2 hairpin coding ends and 2 blunt, 5'-phosphorylated ends""]"	"RAG1"	"[{'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004519', 'name': 'endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043565', 'name': 'sequence-specific DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0061630', 'name': 'ubiquitin protein ligase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0033151', 'name': 'V(D)J recombination', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G5CYK3_PSECU"	"94f2b6795ff47614a08ffbcb178b0d06d6d5e001"	True	False	True	314	"V(D)J recombination-activating protein 1"	3	""	"IAKVFKIDVKGDTDSIHPTQFCHNCWRVMYGRFSSAPCEVYFPRDAAIEWHPHTPSCDICQTARRALKRKGCQTKPSLSKKLKVGVSQARGARCPKSQAQPRNSSKDLMKKITNCSKMHLSTKLLAVDHPVDFVKAISCQICEHILTDPVETTCKHLFCRTCILRCLKVMGSYCPSCQYPCFPTDVESPVRSFVNILNSLVVRCPVKECDKEVSLEKYNQHISSHKEPKESCMYINKGGRPRQHLLSLTRRAQKHRLRELKLQVKAFADKEEGGDLKSVCLTLFLLVLRARNEHRQADELEAIMKGRGSGLQAA"	"unreviewed"	"{'taxId': '37702', 'scientificName': 'Pseudochirops cupreus', 'fullName': 'Pseudochirops cupreus (Coppery ringtail)'}"
