"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5CB36"	"{'domain_architectures': 85233, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'profile': 1, 'cdd': 1, 'ssf': 1, 'panther': 1, 'pirsf': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 85233}"	"['Catalyzes the deamination of dCMP to dUMP, providing the nucleoside monophosphate substrate for the thymidylate synthase/TYMS. Also, part of a nucleotide salvage pathway that eliminates epigenetically modified 5-hydroxymethyl-dCMP (hmdCMP) in a two-step process entailing deamination to cytotoxic 5-hydroxymethyl-dUMP (hmdUMP), followed by its hydrolysis into 5-hydroxymethyluracil (hmU) and 2-deoxy-D-ribose 5-phosphate (deoxyribosephosphate). Catalyzes the first step in that pathway, the deamination of 5-hydroxymethyl-dCMP (hmdCMP)']"	"GW7_20027"	"[{'identifier': 'GO:0004132', 'name': 'dCMP deaminase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006220', 'name': 'pyrimidine nucleotide metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G5CB36_HETGA"	"f99539802ad74cdae12e721eaf57a43643662eeb"	True	False	True	180	"Deoxycytidylate deaminase"	3	""	"PNVSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNAENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDETTAARLMFEMAGVIFRKFTPRCNKIVIDFDSINSQPSQKLQ"	"unreviewed"	"{'taxId': '10181', 'scientificName': 'Heterocephalus glaber', 'fullName': 'Heterocephalus glaber (Naked mole rat)'}"