"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G5B4H1"	"{'domain_architectures': 2885, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2885}"	"['Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions']"	"GW7_06291"	"[{'identifier': 'GO:2001256', 'name': 'regulation of store-operated calcium entry', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005789', 'name': 'endoplasmic reticulum membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G5B4H1_HETGA"	"d7370caaadf6922c1aee2c98c0eaf0bbc9ee50a5"	True	False	True	298	"Store-operated calcium entry-associated regulatory factor"	3	""	"DRILLRDVKALTLHYDRYTTSRRLDPIPQLRCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYRFGKTVVSCEGYDSSEDQYVLRGSCGLEYHLDYTEIGLKKLKESGKQQGFSFSDFYYKIYSADSCATGGLVTIGILLTIAFVVYKLFLSDSQYSPPPYSEYPSYSQHYQRFTGSTGPSPPGFKSEFTGPQNTGRDAASGFGSAFAGQQGHENAGPGFWTGLGTGGILGYLFGSNRAATPFSDSWHHPSYPPPYASTWNSRAYSPPRGDLGGSSACSNSDTKTRTASG"	"unreviewed"	"{'taxId': '10181', 'scientificName': 'Heterocephalus glaber', 'fullName': 'Heterocephalus glaber (Naked mole rat)'}"