"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G4RNQ5"	"{'domain_architectures': 1127, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'ssf': 1, 'pfam': 1, 'cathgene3d': 3, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1127}"	"['Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP']"	"purA"	"[{'identifier': 'GO:0000166', 'name': 'nucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004019', 'name': 'adenylosuccinate synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006164', 'name': 'purine nucleotide biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G4RNQ5_THETK"	"b3163d74b7375ae3f794ac167df1edf6ff5ed0ad"	True	False	False	334	"Adenylosuccinate synthetase"	3	"UP000002654"	"MISVIVDGFFGDVGKGKITAYLALRDSPSLCVRTGAPNAGHTVVFRGAQYVLRTLPSCFVNPSSLLAVAPGALIKTDVFLAEAKAHGADRARVDYNAGVIEERHVEMERSDEHLMKTVGSTGQGVGAAMVERVLRRLRLAKDVEELRPYLADVPGLIQERKRDGVIIEGTQGTFLSLYHGTYPYVTSRDTTASGILSEAGVGPKDVDEVILVFKSFVTRVGNGPLPGELPQDEVARLGWVERGAVTGRPRRAAPFNLELAKRAVMLNSPTQIAITKLDAVFKEAAGKTRFEDLPADAKKWIDDIEAALGRPVTLIGTGPEPEQTIDLRRAKLGP"	"unreviewed"	"{'taxId': '768679', 'scientificName': 'Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1)', 'fullName': 'Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1)'}"