"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G4NS57"	"{'domain_architectures': 32300, 'entries': 27, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'pfam': 2, 'cdd': 1, 'profile': 1, 'ncbifam': 4, 'panther': 1, 'pirsf': 1, 'prints': 1, 'prosite': 2, 'interpro': 10}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32300}"	"['Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released']"	"sigE"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006352', 'name': 'DNA-templated transcription initiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016987', 'name': 'sigma factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G4NS57_BACS4"	"a1f5f88f81e39275f708ccac07d5e39020358a9c"	True	False	False	239	"RNA polymerase sigma factor"	3	"UP000002651"	"MKKLKLRLTHLWYKLLMKLGLKSDEVYYIGGSEALPPPLSKDEEQVLLMKLPNGDQAARAILIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMYLRRNNKIRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDIEANVDKKLLKKALEQLNEREKQIMELRFGLVGEEEKTQKDVADMMGISQSYISRLEKRIIKRLRKEFNKMV"	"unreviewed"	"{'taxId': '1052585', 'scientificName': 'Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10)', 'fullName': 'Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10)'}"
