"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G4N7G3"	"{'domain_architectures': 4129, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4129}"	"['Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER)']"	"MGG_03572"	"[{'identifier': 'GO:0008312', 'name': '7S RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006614', 'name': 'SRP-dependent cotranslational protein targeting to membrane', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0048500', 'name': 'signal recognition particle', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0030942', 'name': 'endoplasmic reticulum signal peptide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005786', 'name': 'signal recognition particle, endoplasmic reticulum targeting', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G4N7G3_PYRO7"	"2ff6f03da45f94110b27a193ccd4563d512dd546"	True	False	False	127	"Signal recognition particle subunit SRP14"	3	"UP000009058"	"MGRVTNEEFFIKLAELFAARKGDDHGQIHLTQKRLSHDAPQSSDPDADLHPEKPLPIVVRASNGKGRGAKKEKLSLSTTVDPEGLDSFYARYAEVCKAGMVALKPRDKSKKKAKAKKRKGGAVTGKA"	"unreviewed"	"{'taxId': '242507', 'scientificName': 'Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)', 'fullName': 'Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus)'}"