"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3R9Z6"	"{'domain_architectures': 3055, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3055}"	"['Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity']"	"TMEM258"	"[{'identifier': 'GO:0008250', 'name': 'oligosaccharyltransferase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G3R9Z6_GORGO"	"0dbd3688e917ac755760d9f88c4252c9ea7fa8e3"	True	False	False	79	"Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit TMEM258"	3	"UP000001519"	"MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV"	"unreviewed"	"{'taxId': '9595', 'scientificName': 'Gorilla gorilla gorilla', 'fullName': 'Gorilla gorilla gorilla (Western lowland gorilla)'}"