General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3QWP1",
        "id": "G3QWP1_GORGO",
        "source_organism": {
            "taxId": "9595",
            "scientificName": "Gorilla gorilla gorilla",
            "fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
        },
        "name": "Nuclear receptor subfamily 1 group I member 2",
        "description": [
            "Nuclear receptor that acts as a transcription factor regulating genes involved in the metabolism and excretion of xenobiotics, drugs, and endogenous compounds. Activated by a broad range of endogenous steroids (e.g. pregnenolone, progesterone) and xenobiotics, including the antibiotic rifampicin and certain plant-derived metabolites. Upon ligand binding, translocates to the nucleus, forms a heterodimer with the retinoid X receptor/RXR, and binds to response elements in target promoters, leading to transcriptional activation. Target genes include cytochrome P450 enzymes such as CYP3A4 and ATP-binding cassette transporters including ABCB1/MDR1"
        ],
        "length": 473,
        "sequence": "MTVTRTHHFKEGSLRAPATPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADNGGKEIFSLLPHMADMSTYMFKGIINFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVVQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS",
        "proteome": "UP000001519",
        "gene": "NR1I2",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "4698babba05c618fbf7c3347fb2b74999f10e47e",
        "counters": {
            "domain_architectures": 59427,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "profile": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 2,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 59427
        }
    }
}