"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3B861"	"{'domain_architectures': 29684, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'cdd': 1, 'profile': 1, 'pfam': 2, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29684}"	"['The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity']"	"CANTEDRAFT_115821"	"[{'identifier': 'GO:0006511', 'name': 'ubiquitin-dependent protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0019773', 'name': 'proteasome core complex, alpha-subunit complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0043161', 'name': 'proteasome-mediated ubiquitin-dependent protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030163', 'name': 'protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005839', 'name': 'proteasome core complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G3B861_CANTC"	"b4fc3eb7060592e47b710df6e92c52ef7477efb8"	True	False	False	255	"Proteasome subunit alpha type"	3	"UP000000707"	"MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRVTSPLLEHSSIEKILEVDRHIGCAMSGLTADARSMIDHARVSSLTHDLYYDEEIQVESLTQSVCDLALRFGEGAGGEKRLMSRPFGVALLIAGIDKQNGPQLYHAEPSGTFYRYDAKAIGSGSEGAQAELQNEYHKSLTLKEAELLALKILKQVMEEKLDCKNAQLASVTAEKGFRIYSDEETDEIIKALNEQQAETEEAQD"	"unreviewed"	"{'taxId': '590646', 'scientificName': 'Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70)', 'fullName': 'Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast)'}"
