"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G3B714"	"{'domain_architectures': 3254, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3254}"	"['Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. May participate in merging the COX1 and COX2 assembly lines']"	"CANTEDRAFT_114382"	"[{'identifier': 'GO:0031966', 'name': 'mitochondrial membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G3B714_CANTC"	"93131471f0f8a6284e632ca614784161f29b678c"	True	False	False	124	"Cytochrome c oxidase assembly protein COX16, mitochondrial"	3	"UP000000707"	"MVYLGNHVFRGKKAQQAYDKTFAGKYQRLLQRNHFLYFGLPFMLSIVAGSIYLQNFTAVKWEKYDAKYRQLNEAEMLDMIENKRKVDKKNDYYRLQGFVDEQKDNDFDYEMIRVKRKKEDEPVW"	"unreviewed"	"{'taxId': '590646', 'scientificName': 'Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70)', 'fullName': 'Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM Y-70) (Yeast)'}"
