"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2ZDP0"	"{'domain_architectures': 32397, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ncbifam': 2, 'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 32397}"	"[""Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein""]"	"acpS"	"[{'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008897', 'name': 'holo-[acyl-carrier-protein] synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006633', 'name': 'fatty acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G2ZDP0_LISIP"	"e95bd032824ec42d20f1a59244ad0c4ab2df36cb"	True	False	False	118	"Holo-[acyl-carrier-protein] synthase"	3	""	"MIKGIGLDMIDLARVKQVLEKNPRFMERILTEKEISQFEKYEGSRKIEFLAGRFAAKEAYAKANGTGFGKHLSFTDVEILQVEDGRPHVTMPIKPGESVFVSITHTARSAAAQVIIEV"	"unreviewed"	"{'taxId': '881621', 'scientificName': 'Listeria ivanovii (strain ATCC BAA-678 / PAM 55)', 'fullName': 'Listeria ivanovii (strain ATCC BAA-678 / PAM 55)'}"