"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2SPS5"	"{'domain_architectures': 45842, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pirsf': 1, 'prints': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 45842}"	"['Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions']"	"def"	"[{'identifier': 'GO:0042586', 'name': 'peptide deformylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G2SPS5_LIGR2"	"fa547ef24adbcac0a50b8b949cdd967c1ce8b23b"	True	False	False	184	"Peptide deformylase"	3	"UP000001279"	"MLTMDDIIREGHPTLRARAEKIAFPLSDEDLKLAHDLMEFLENSQDEKIAKKYKLRAGVGLAAPQVDASKRMTAVLVPDEEGKPPFFKHVLVNPTILSESVQMAALSEGEGCLSVDREVPGYVPRHERIKLRWYDLDGNEHVERLRDYTAIVVQHEIDHLNGIMFYDHINQENPFFKPNDLVLL"	"unreviewed"	"{'taxId': '1069534', 'scientificName': 'Ligilactobacillus ruminis (strain ATCC 27782 / RF3)', 'fullName': 'Ligilactobacillus ruminis (strain ATCC 27782 / RF3)'}"