"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2QXA1"	"{'domain_architectures': 4753, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'smart': 1, 'pfam': 2, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4753}"	"['Transcriptional coactivator that stimulates GCN4-dependent transcriptional activity by bridging the DNA-binding region of GCN4 and TBP (SPT15), thereby recruiting TBP to GCN4-bound promoters. Involved in induction of the ribosome quality control (RQC) pathway; a pathway that degrades nascent peptide chains during problematic translation. Required to prevent stalled ribosomes from frameshifting']"	"THITE_2027442"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G2QXA1_THETT"	"97cfd6958e770311f31d80685118ee36ab5721ce"	True	False	True	161	"Multiprotein-bridging factor 1"	3	"UP000008181"	"MSAWDIAEVKIGKNVSRGGGAPRETVVRGQSALNAARRSGATITTEKKFSTGNAASKPAVEGQRLTMVDRADDIVKPKTVGAEVGKAIQKARNEYAQANGGKGLTQKELATKCNTTPSVVAAFERGDAAPDQKVLAAMERVLNVKLRGSDIGKPKFEKKEK"	"unreviewed"	"{'taxId': '578455', 'scientificName': 'Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126)', 'fullName': 'Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126)'}"
