"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2QIT6"	"{'domain_architectures': 5083, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5083}"	"['Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability']"	"MYCTH_2315781"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G2QIT6_THET4"	"46fe84434190a5585075fa61821a0abc56a783af"	True	False	False	87	"40S ribosomal protein S21"	3	"UP000007322"	"MENDRGEIVDLYVPRKCSATGRIIRAKDHGSCQITVAKVDENGRAIQGENIIYALSGFVRAMGESDDSLNRLAQRDGLLKNVWSAQR"	"unreviewed"	"{'taxId': '573729', 'scientificName': 'Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)', 'fullName': 'Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)'}"