"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G2Q9T3"	"{'domain_architectures': 2831, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'smart': 1, 'pfam': 2, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2831}"	"['Lytic polysaccharide monooxygenase (LPMO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding C1 or C4 oxidation products (PubMed:22342036, PubMed:35450635). Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate (Probable). Hydrolyzes weakly barley beta-glucan, carboxymethyl cellulose, lichenan, wheat arabinoxylan and birchwood xylan (PubMed:22342036, PubMed:35450635). Stimulates the hydrolysis of lignocellulosic substrates (such as hydrothermal pretreated wheat straw or steam-pretreated spruce), when combined with other cellulolytic enzymes (PubMed:22342036)']"	"LPMO9H"	"[{'identifier': 'GO:0030248', 'name': 'cellulose binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005975', 'name': 'carbohydrate metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"LP9H_THET4"	"0ee351bc19c4eac8c2647414ef821eabcc14df1e"	True	False	False	342	"AA9 family lytic polysaccharide monooxygenase H"	1	"UP000007322"	"MSKASALLAGLTGAALVAAHGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPESHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKAGNYVLRHEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYSQCL"	"reviewed"	"{'taxId': '573729', 'scientificName': 'Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)', 'fullName': 'Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)'}"