"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G1TPE6"	"{'domain_architectures': 28756, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 2, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28756}"	"['Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER). Forms a ribosome receptor and a gated pore in the ER membrane, both functions required for cotranslational translocation of nascent polypeptides. The SEC61 channel is also involved in ER membrane insertion of transmembrane proteins: it mediates membrane insertion of the first few transmembrane segments of proteins, while insertion of subsequent transmembrane regions of multi-pass membrane proteins is mediated by the multi-pass translocon (MPT) complex. The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER']"	"SEC61G"	"[{'identifier': 'GO:0008320', 'name': 'protein transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0006605', 'name': 'protein targeting', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G1TPE6_RABIT"	"0d41e4e71441ccac4f46a43da1a097dd754b8912"	True	False	False	68	"Protein transport protein Sec61 subunit gamma"	1	"UP000001811"	"MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG"	"unreviewed"	"{'taxId': '9986', 'scientificName': 'Oryctolagus cuniculus', 'fullName': 'Oryctolagus cuniculus (Rabbit)'}"